Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte5j19
         (726 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_0821 - 25003001-25003336,25004248-25004376,25004984-250050...    29   3.8  

>06_03_0821 -
           25003001-25003336,25004248-25004376,25004984-25005040,
           25005435-25005539
          Length = 208

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 19/65 (29%), Positives = 32/65 (49%)
 Frame = -2

Query: 317 TEKGIAFTRIRSRLICHIQTCISGHLSAGLQSRFIFDRILITKLIECGIKIRAGLVRGWA 138
           T +G+  +R ++ +    Q   SG +  G+ S  +   I   KL  CG+++RAGL   + 
Sbjct: 5   TSQGVKPSRAQADICMKSQQSKSGMIHTGILSYSLTITIEFCKL--CGLELRAGLPLSFL 62

Query: 137 GGRAP 123
            G  P
Sbjct: 63  EGLPP 67


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,512,770
Number of Sequences: 37544
Number of extensions: 293412
Number of successful extensions: 602
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 585
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 601
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1898162308
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)