Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte4k15
         (244 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ004400-1|AAY21239.1|  144|Anopheles gambiae lysozyme c-5 protein.    26   0.22 
AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal...    23   2.0  
CR954256-9|CAJ14150.1|  872|Anopheles gambiae putative calcium/c...    21   8.2  

>DQ004400-1|AAY21239.1|  144|Anopheles gambiae lysozyme c-5 protein.
          Length = 144

 Score = 25.8 bits (54), Expect = 0.22
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 6/50 (12%)
 Frame = -2

Query: 132 WVSDC*CVRTLSCDSW*HED--ED---GHSIYGKSFSHSYTSWR-ECEGR 1
           W++   C   L C S  ++D  +D     SIY +SF +S+  WR  C+G+
Sbjct: 84  WIAGNEC--HLKCSSLVNDDISDDMRCARSIYRRSFFNSWEGWRNNCQGK 131


>AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal
           growth factor receptorprotein.
          Length = 1433

 Score = 22.6 bits (46), Expect = 2.0
 Identities = 9/18 (50%), Positives = 10/18 (55%)
 Frame = +3

Query: 39  KMICRKCYARLHPRATNC 92
           K +CRKC    HPR   C
Sbjct: 633 KAVCRKC----HPRCKKC 646


>CR954256-9|CAJ14150.1|  872|Anopheles gambiae putative
           calcium/calmodulin-dependentprotein kinase, CAKI
           protein.
          Length = 872

 Score = 20.6 bits (41), Expect = 8.2
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = -1

Query: 112 CPHFVLRQLVAR 77
           CPH++  ++VAR
Sbjct: 163 CPHYMAPEVVAR 174


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 222,098
Number of Sequences: 2352
Number of extensions: 3881
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 563,979
effective HSP length: 53
effective length of database: 439,323
effective search space used: 11861721
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)