BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmte4k09
(738 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 23 2.3
AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 22 5.2
EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.9
EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.9
EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.9
EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.9
EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.9
EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 22 6.9
DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 22 6.9
DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 22 6.9
>DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450
monooxygenase protein.
Length = 517
Score = 23.4 bits (48), Expect = 2.3
Identities = 9/29 (31%), Positives = 16/29 (55%)
Frame = +3
Query: 411 FYPLNVIYDFLDALERQYPSICTVTVIGN 497
+Y LN I+D L ++Y ++C + N
Sbjct: 73 YYKLNKIHDAYKDLNQRYGALCKEEALWN 101
>AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha
protein precursor protein.
Length = 153
Score = 22.2 bits (45), Expect = 5.2
Identities = 14/54 (25%), Positives = 25/54 (46%)
Frame = +2
Query: 428 YLRFPRCVRAPIPVDLHGNRYWQYSGRQGCQG*IDVENFK**RQKYSCLAGRDN 589
+L++P CV PIP Y+ R C + V K + + SC+ +++
Sbjct: 37 FLQYPGCVPKPIP---------SYACRGRCSSYLQVSGSKIWQMERSCMCCQES 81
>EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine
receptor subunitalpha 6 transcript variant 6 protein.
Length = 461
Score = 21.8 bits (44), Expect = 6.9
Identities = 6/13 (46%), Positives = 10/13 (76%)
Frame = +3
Query: 663 LPDYITNKDWFFV 701
L D+ITN +W+ +
Sbjct: 151 LSDFITNGEWYLI 163
>EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine
receptor subunitalpha 6 transcript variant 5 protein.
Length = 461
Score = 21.8 bits (44), Expect = 6.9
Identities = 6/13 (46%), Positives = 10/13 (76%)
Frame = +3
Query: 663 LPDYITNKDWFFV 701
L D+ITN +W+ +
Sbjct: 151 LSDFITNGEWYLI 163
>EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine
receptor subunitalpha 6 transcript variant 4 protein.
Length = 461
Score = 21.8 bits (44), Expect = 6.9
Identities = 6/13 (46%), Positives = 10/13 (76%)
Frame = +3
Query: 663 LPDYITNKDWFFV 701
L D+ITN +W+ +
Sbjct: 151 LSDFITNGEWYLI 163
>EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine
receptor subunitalpha 6 transcript variant 3 protein.
Length = 461
Score = 21.8 bits (44), Expect = 6.9
Identities = 6/13 (46%), Positives = 10/13 (76%)
Frame = +3
Query: 663 LPDYITNKDWFFV 701
L D+ITN +W+ +
Sbjct: 151 LSDFITNGEWYLI 163
>EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine
receptor subunitalpha 6 transcript variant 2 protein.
Length = 461
Score = 21.8 bits (44), Expect = 6.9
Identities = 6/13 (46%), Positives = 10/13 (76%)
Frame = +3
Query: 663 LPDYITNKDWFFV 701
L D+ITN +W+ +
Sbjct: 151 LSDFITNGEWYLI 163
>EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine
receptor subunitalpha 6 transcript variant 1 protein.
Length = 461
Score = 21.8 bits (44), Expect = 6.9
Identities = 6/13 (46%), Positives = 10/13 (76%)
Frame = +3
Query: 663 LPDYITNKDWFFV 701
L D+ITN +W+ +
Sbjct: 151 LSDFITNGEWYLI 163
>DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine
receptor alpha6subunit protein.
Length = 529
Score = 21.8 bits (44), Expect = 6.9
Identities = 6/13 (46%), Positives = 10/13 (76%)
Frame = +3
Query: 663 LPDYITNKDWFFV 701
L D+ITN +W+ +
Sbjct: 219 LSDFITNGEWYLI 231
>DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine
receptor alpha6subunit protein.
Length = 529
Score = 21.8 bits (44), Expect = 6.9
Identities = 6/13 (46%), Positives = 10/13 (76%)
Frame = +3
Query: 663 LPDYITNKDWFFV 701
L D+ITN +W+ +
Sbjct: 219 LSDFITNGEWYLI 231
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 203,979
Number of Sequences: 438
Number of extensions: 4380
Number of successful extensions: 11
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23023035
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -