BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmte4c19
(651 letters)
Database: arabidopsis
28,952 sequences; 12,070,560 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
At2g25740.1 68415.m03089 ATP-dependent protease La (LON) domain-... 28 6.2
>At2g25740.1 68415.m03089 ATP-dependent protease La (LON)
domain-containing protein low similarity to protease Lon
[Pseudomonas fluorescens] GI:7644385; contains Pfam
profile PF02190: ATP-dependent protease La (LON) domain
Length = 547
Score = 27.9 bits (59), Expect = 6.2
Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 2/60 (3%)
Frame = -3
Query: 205 SFKSELQGGQRYEFFISWSSI--FTTGL*MIINRSTYLQIPKDNPDNKIILATFHSNFPL 32
SF +G QR+ W+ + FT G I++ L+ P+D + L+ +PL
Sbjct: 174 SFNVITRGQQRFRLKHRWTDVEGFTCGEVQIVDEDVPLRTPRDAFGKLVPLSKLRGRYPL 233
Database: arabidopsis
Posted date: Oct 4, 2007 10:56 AM
Number of letters in database: 12,070,560
Number of sequences in database: 28,952
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,663,281
Number of Sequences: 28952
Number of extensions: 264360
Number of successful extensions: 540
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 532
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 540
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1354097952
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -