SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte3d17
         (727 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    27   0.18 
AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic ac...    22   6.8  
DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chlor...    21   9.0  
DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chlor...    21   9.0  

>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 27.1 bits (57), Expect = 0.18
 Identities = 9/37 (24%), Positives = 21/37 (56%)
 Frame = -3

Query: 323 LWVLYHLKVYLNCPSYKCFKKLLIYDYDYLHERNLVF 213
           LW +   K + +  + + +   ++  +DYLH RN+++
Sbjct: 453 LWTVLRDKGHFDDGTTRFYTACVVEAFDYLHSRNIIY 489


>AY540846-1|AAS48080.1|  541|Apis mellifera neuronal nicotinic
           acetylcholine receptorApisa2 subunit protein.
          Length = 541

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 7/16 (43%), Positives = 10/16 (62%)
 Frame = +3

Query: 678 YIPQIPWCSVGYPAKR 725
           Y P + W  +G PA+R
Sbjct: 195 YYPSVEWDILGVPAER 210


>DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +2

Query: 656 NYGRREDLHSSN 691
           NY  R D+HS N
Sbjct: 326 NYASRSDMHSDN 337


>DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = +2

Query: 656 NYGRREDLHSSN 691
           NY  R D+HS N
Sbjct: 326 NYASRSDMHSDN 337


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 189,433
Number of Sequences: 438
Number of extensions: 4196
Number of successful extensions: 9
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22535775
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -