SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte30p08
         (733 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc...    23   7.4  
AF515527-1|AAM61894.1|  211|Anopheles gambiae glutathione S-tran...    23   9.7  

>EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium
            channel alpha1 subunit protein.
          Length = 1893

 Score = 23.4 bits (48), Expect = 7.4
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = +3

Query: 12   YVYSLVVYQFKNYF 53
            +V+ L  ++FKNYF
Sbjct: 1222 FVFKLAAFRFKNYF 1235


>AF515527-1|AAM61894.1|  211|Anopheles gambiae glutathione
           S-transferase D10 protein.
          Length = 211

 Score = 23.0 bits (47), Expect = 9.7
 Identities = 10/30 (33%), Positives = 15/30 (50%)
 Frame = +3

Query: 129 LNSAREQIKSENPGLRVTEIAKKGGEIWKS 218
           L   REQ++  NP   +    + G  IW+S
Sbjct: 35  LPEVREQLRKFNPQHTIPTFIEDGHVIWES 64


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 617,566
Number of Sequences: 2352
Number of extensions: 9637
Number of successful extensions: 17
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 74844540
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -