BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmte30o07
(793 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 24 4.7
AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 24 6.2
>AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR
protein.
Length = 640
Score = 24.2 bits (50), Expect = 4.7
Identities = 7/12 (58%), Positives = 10/12 (83%)
Frame = -2
Query: 198 FTDIFLLKYWPF 163
F +F+L+YWPF
Sbjct: 194 FISLFVLQYWPF 205
>AF395079-1|AAK97461.1| 371|Anopheles gambiae basic
helix-loop-helix transcriptionfactor ASH protein.
Length = 371
Score = 23.8 bits (49), Expect = 6.2
Identities = 14/46 (30%), Positives = 24/46 (52%)
Frame = +1
Query: 463 AKKNILSCNANTKASGINSTFRRSFSDDKNRSNPQFSNSTIMVEHG 600
+ N LS ++ AS +ST+ + S+ N S+P S+ + HG
Sbjct: 187 SSSNQLSNSSLCSASSGSSTYYGTMSEPSNASSPAPSHLSDHSSHG 232
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 759,632
Number of Sequences: 2352
Number of extensions: 14269
Number of successful extensions: 17
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 83160600
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -