SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte30h22
         (694 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_04_0091 + 17241555-17241602,17241685-17241822,17241901-172421...    29   3.5  

>03_04_0091 +
           17241555-17241602,17241685-17241822,17241901-17242198,
           17242281-17242513,17242632-17242827,17242911-17243032,
           17243100-17243165,17243373-17243436,17243851-17244176
          Length = 496

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 18/72 (25%), Positives = 31/72 (43%)
 Frame = +3

Query: 279 KMSRASVFKTFF*IEIVKMTKYKLNNTIRSSPEVTLTAYIADDAKKPDEKKYEIAVLDSN 458
           K S AS+  T   +++  M +  L   ++  P         + ++KP  K  +   +  N
Sbjct: 233 KKSYASITLTMIALQVKVMKEVSLTPVVKPKPAPKHVVKTVEASEKPSVKSSQTVEITPN 292

Query: 459 QNDSAVNENNRS 494
            N+ A  ENN S
Sbjct: 293 DNNDA--ENNTS 302


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,387,163
Number of Sequences: 37544
Number of extensions: 296427
Number of successful extensions: 673
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 666
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 673
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1768474200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -