SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte30e04
         (160 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyc...    23   4.1  
SPCC16A11.01 ||SPCC63.15|conserved fungal protein|Schizosaccharo...    23   5.4  

>SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 987

 Score = 23.4 bits (48), Expect = 4.1
 Identities = 9/31 (29%), Positives = 13/31 (41%)
 Frame = +3

Query: 6   CYRYNLCHCIYPSITAAPEILFFFFFLQTTY 98
           C+ Y + +CI              FF+QT Y
Sbjct: 799 CFTYWIINCILEKKNTKARTAVISFFIQTAY 829


>SPCC16A11.01 ||SPCC63.15|conserved fungal
           protein|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 328

 Score = 23.0 bits (47), Expect = 5.4
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +1

Query: 1   IYVIGIICVIAF 36
           I V+GIIC IAF
Sbjct: 185 IIVVGIICAIAF 196


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 527,528
Number of Sequences: 5004
Number of extensions: 6040
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 2,362,478
effective HSP length: 33
effective length of database: 2,197,346
effective search space used: 41749574
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -