Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte30b14
         (749 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090815-1|BAC57905.1|  492|Anopheles gambiae gag-like protein p...    25   1.9  
AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p...    24   4.4  
AY344822-1|AAR02433.1|  257|Anopheles gambiae CP5039 protein.          23   7.6  
AY344821-1|AAR02432.1|  257|Anopheles gambiae CP5039 protein.          23   7.6  
AY344820-1|AAR02431.1|  257|Anopheles gambiae CP5039 protein.          23   7.6  
AY344819-1|AAR02430.1|  257|Anopheles gambiae CP5039 protein.          23   7.6  
AY344818-1|AAR02429.1|  257|Anopheles gambiae CP5039 protein.          23   7.6  
AY344817-1|AAR02428.1|  257|Anopheles gambiae CP5039 protein.          23   7.6  
AY344816-1|AAR02427.1|  257|Anopheles gambiae CP5039 protein.          23   7.6  
AY344815-1|AAR02426.1|  257|Anopheles gambiae CP5039 protein.          23   7.6  

>AB090815-1|BAC57905.1|  492|Anopheles gambiae gag-like protein
           protein.
          Length = 492

 Score = 25.4 bits (53), Expect = 1.9
 Identities = 11/20 (55%), Positives = 12/20 (60%), Gaps = 1/20 (5%)
 Frame = +3

Query: 63  TSRFEK-CKGPRRRDCSDVK 119
           T  F + CKGP R DC  VK
Sbjct: 424 TGHFSRDCKGPDRTDCDAVK 443


>AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal
           ion/proton exchanger 3 protein.
          Length = 1221

 Score = 24.2 bits (50), Expect = 4.4
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = +2

Query: 206 NYXLYFGNWRGISKFLNNRRTSLRKDGTEQRQAWRHYVFKLNLQDISQKYFDGNY 370
           NY +     R IS+  +++R+   KDG +Q     H  F   +Q+ S K F  +Y
Sbjct: 831 NYKMQMNIRRMISEKKHHKRSKRVKDGKQQ----NHVSFPEFVQNGSAKQFANDY 881


>AY344822-1|AAR02433.1|  257|Anopheles gambiae CP5039 protein.
          Length = 257

 Score = 23.4 bits (48), Expect = 7.6
 Identities = 9/10 (90%), Positives = 10/10 (100%)
 Frame = +1

Query: 373 LRKLDFSYNL 402
           LRKLD+SYNL
Sbjct: 160 LRKLDYSYNL 169


>AY344821-1|AAR02432.1|  257|Anopheles gambiae CP5039 protein.
          Length = 257

 Score = 23.4 bits (48), Expect = 7.6
 Identities = 9/10 (90%), Positives = 10/10 (100%)
 Frame = +1

Query: 373 LRKLDFSYNL 402
           LRKLD+SYNL
Sbjct: 160 LRKLDYSYNL 169


>AY344820-1|AAR02431.1|  257|Anopheles gambiae CP5039 protein.
          Length = 257

 Score = 23.4 bits (48), Expect = 7.6
 Identities = 9/10 (90%), Positives = 10/10 (100%)
 Frame = +1

Query: 373 LRKLDFSYNL 402
           LRKLD+SYNL
Sbjct: 160 LRKLDYSYNL 169


>AY344819-1|AAR02430.1|  257|Anopheles gambiae CP5039 protein.
          Length = 257

 Score = 23.4 bits (48), Expect = 7.6
 Identities = 9/10 (90%), Positives = 10/10 (100%)
 Frame = +1

Query: 373 LRKLDFSYNL 402
           LRKLD+SYNL
Sbjct: 160 LRKLDYSYNL 169


>AY344818-1|AAR02429.1|  257|Anopheles gambiae CP5039 protein.
          Length = 257

 Score = 23.4 bits (48), Expect = 7.6
 Identities = 9/10 (90%), Positives = 10/10 (100%)
 Frame = +1

Query: 373 LRKLDFSYNL 402
           LRKLD+SYNL
Sbjct: 160 LRKLDYSYNL 169


>AY344817-1|AAR02428.1|  257|Anopheles gambiae CP5039 protein.
          Length = 257

 Score = 23.4 bits (48), Expect = 7.6
 Identities = 9/10 (90%), Positives = 10/10 (100%)
 Frame = +1

Query: 373 LRKLDFSYNL 402
           LRKLD+SYNL
Sbjct: 160 LRKLDYSYNL 169


>AY344816-1|AAR02427.1|  257|Anopheles gambiae CP5039 protein.
          Length = 257

 Score = 23.4 bits (48), Expect = 7.6
 Identities = 9/10 (90%), Positives = 10/10 (100%)
 Frame = +1

Query: 373 LRKLDFSYNL 402
           LRKLD+SYNL
Sbjct: 160 LRKLDYSYNL 169


>AY344815-1|AAR02426.1|  257|Anopheles gambiae CP5039 protein.
          Length = 257

 Score = 23.4 bits (48), Expect = 7.6
 Identities = 9/10 (90%), Positives = 10/10 (100%)
 Frame = +1

Query: 373 LRKLDFSYNL 402
           LRKLD+SYNL
Sbjct: 160 LRKLDYSYNL 169


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 692,350
Number of Sequences: 2352
Number of extensions: 13421
Number of successful extensions: 29
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 29
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 77339358
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)