BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmte30a12
(747 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_A1IE49 Cluster: Hydroxyacylglutathione hydrolase W; n=1... 36 1.1
>UniRef50_A1IE49 Cluster: Hydroxyacylglutathione hydrolase W; n=1;
Candidatus Desulfococcus oleovorans Hxd3|Rep:
Hydroxyacylglutathione hydrolase W - Candidatus
Desulfococcus oleovorans Hxd3
Length = 220
Score = 35.9 bits (79), Expect = 1.1
Identities = 18/59 (30%), Positives = 27/59 (45%)
Frame = -3
Query: 571 DPAVDTLMTQLSLCS*ASFVGAPVVVNKHTPPCCAHACPVYLGGEKMHSHKNDSNLLLG 395
DPA DT + + + A V + H CC +A + G ++H HK D+ L G
Sbjct: 38 DPAFDTGRILAAAATAGFTITAVVNTHGHADHCCGNAAVMGASGARLHIHKKDARQLTG 96
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 649,156,364
Number of Sequences: 1657284
Number of extensions: 12155928
Number of successful extensions: 25418
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 24656
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25409
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 61323318355
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -