Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte2p19
         (632 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory recept...    22   3.7  
AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory recept...    22   3.7  
AY873916-1|AAW67572.1|  377|Tribolium castaneum chitinase 6 prot...    21   8.6  

>AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory receptor
           candidate 18 protein.
          Length = 387

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 8/12 (66%), Positives = 12/12 (100%)
 Frame = +3

Query: 237 ELSSKKNRSLGN 272
           +L++KKN+SLGN
Sbjct: 372 DLNNKKNQSLGN 383


>AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory receptor
           candidate 17 protein.
          Length = 372

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 8/12 (66%), Positives = 12/12 (100%)
 Frame = +3

Query: 237 ELSSKKNRSLGN 272
           +L++KKN+SLGN
Sbjct: 357 DLNNKKNQSLGN 368


>AY873916-1|AAW67572.1|  377|Tribolium castaneum chitinase 6
           protein.
          Length = 377

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 12/41 (29%), Positives = 17/41 (41%)
 Frame = -3

Query: 450 KFTNREVIYTTGTH*NVVILIFNDGNIWISFEVIKFLTNTG 328
           KFT  ++     TH N   L  ND    +  +    +TN G
Sbjct: 39  KFTPEDIDANLCTHVNYAFLGLNDDGSLLILDNATDITNGG 79


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 131,960
Number of Sequences: 336
Number of extensions: 2830
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 16292796
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)