SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte29f20
         (537 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM042695-1|CAJ14970.1|  396|Anopheles gambiae 3-hydroxykynurenin...    27   0.40 
AY750997-1|AAV31069.1|  153|Anopheles gambiae peritrophin-1 prot...    23   6.5  
AY344823-1|AAR02434.1|  153|Anopheles gambiae peritrophin A prot...    23   6.5  

>AM042695-1|CAJ14970.1|  396|Anopheles gambiae 3-hydroxykynurenine
           transaminase protein.
          Length = 396

 Score = 27.1 bits (57), Expect = 0.40
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = -2

Query: 401 YSRNNVIIKYSSGLGRTFGEGEEAGSSGRLAS 306
           Y+ NN  ++   GLG TFG+    G  G  ++
Sbjct: 334 YAMNNFSLEVQGGLGPTFGKAWRVGIMGECST 365


>AY750997-1|AAV31069.1|  153|Anopheles gambiae peritrophin-1
           protein.
          Length = 153

 Score = 23.0 bits (47), Expect = 6.5
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +1

Query: 325 EPASSPSPNVLP 360
           EPAS PSPN  P
Sbjct: 86  EPASKPSPNCPP 97


>AY344823-1|AAR02434.1|  153|Anopheles gambiae peritrophin A
           protein.
          Length = 153

 Score = 23.0 bits (47), Expect = 6.5
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +1

Query: 325 EPASSPSPNVLP 360
           EPAS PSPN  P
Sbjct: 86  EPASKPSPNCPP 97


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 495,578
Number of Sequences: 2352
Number of extensions: 9106
Number of successful extensions: 18
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 49897362
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -