BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmte29d14
(627 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 24 3.4
AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 3.4
>DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein.
Length = 407
Score = 24.2 bits (50), Expect = 3.4
Identities = 12/32 (37%), Positives = 18/32 (56%)
Frame = -2
Query: 596 KDKGQTQPHVVGHED*HQHVRGGRLNEVEARL 501
K G PHV+ ++ QH+ G NE+ A+L
Sbjct: 367 KVSGSIMPHVLWNKLGRQHMLGVLGNEIAAQL 398
>AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine
protease protein.
Length = 1322
Score = 24.2 bits (50), Expect = 3.4
Identities = 7/13 (53%), Positives = 10/13 (76%)
Frame = -1
Query: 228 HDCGHVQRMGRRC 190
H+CGH + +G RC
Sbjct: 1013 HNCGHTEDVGVRC 1025
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 653,878
Number of Sequences: 2352
Number of extensions: 14219
Number of successful extensions: 29
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 28
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 61050630
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -