SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte29a16
         (661 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY898652-1|AAX83121.1|  349|Apis mellifera AKH receptor protein.       23   2.0  
DQ863218-1|ABI94394.1|  399|Apis mellifera tyramine receptor pro...    21   7.9  
DQ863217-1|ABI94393.1|  399|Apis mellifera tyramine receptor pro...    21   7.9  
AJ245824-1|CAB76374.1|  399|Apis mellifera G-protein coupled rec...    21   7.9  

>AY898652-1|AAX83121.1|  349|Apis mellifera AKH receptor protein.
          Length = 349

 Score = 23.4 bits (48), Expect = 2.0
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = -3

Query: 140 WTLTLSNFVELLKRVKKFFGPNILSSIFIR*LNLILVTKSLKVML 6
           W +  SN+ ELL    +F   +I+S +F   L +I    +  V++
Sbjct: 16  WRVNNSNYTELLPIDMRFNEGHIVSIVFYSVLMIISAIGNTTVLI 60


>DQ863218-1|ABI94394.1|  399|Apis mellifera tyramine receptor
           protein.
          Length = 399

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -3

Query: 272 LEPNKPCNMTR 240
           LEP  PC +TR
Sbjct: 182 LEPGTPCQLTR 192


>DQ863217-1|ABI94393.1|  399|Apis mellifera tyramine receptor
           protein.
          Length = 399

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -3

Query: 272 LEPNKPCNMTR 240
           LEP  PC +TR
Sbjct: 182 LEPGTPCQLTR 192


>AJ245824-1|CAB76374.1|  399|Apis mellifera G-protein coupled
           receptor protein.
          Length = 399

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -3

Query: 272 LEPNKPCNMTR 240
           LEP  PC +TR
Sbjct: 182 LEPGTPCQLTR 192


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 172,693
Number of Sequences: 438
Number of extensions: 3092
Number of successful extensions: 7
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19855845
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -