SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte26l23
         (672 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB209559-1|BAD92796.1|  371|Homo sapiens SPRY domain-containing ...    31   2.8  

>AB209559-1|BAD92796.1|  371|Homo sapiens SPRY domain-containing
           SOCS box protein SSB-1 variant protein.
          Length = 371

 Score = 31.5 bits (68), Expect = 2.8
 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 1/56 (1%)
 Frame = +3

Query: 327 RNRKYRPTTSCKAESEHHTGESHYARP-RGSEVGYFEVLSLQHDGCARTEHAAACR 491
           R+R   P     A           ARP R S +G  E    +H G   TEH AACR
Sbjct: 3   RSRNQAPGAGAGAAGRRRLRSLRRARPGRPSLLGLGEQRRRRHRGRGNTEHCAACR 58


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.313    0.129    0.405 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 86,058,469
Number of Sequences: 237096
Number of extensions: 1832833
Number of successful extensions: 3561
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3325
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3554
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7647512560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)

- SilkBase 1999-2023 -