Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte25p08
         (688 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex det...    22   4.8  
DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex det...    22   4.8  
AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex det...    22   4.8  
AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex det...    22   4.8  
AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex det...    22   4.8  
AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    22   4.8  
AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex det...    22   4.8  
AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex det...    22   4.8  
S78459-1|AAB34403.1|   50|Apis mellifera mast cell-degranulating...    22   6.3  

>DQ325089-1|ABD14103.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.2 bits (45), Expect = 4.8
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +1

Query: 97  KIYYNILHINQL 132
           K+YYNI++I Q+
Sbjct: 111 KLYYNIINIEQI 122


>DQ325088-1|ABD14102.1|  185|Apis mellifera complementary sex
           determiner protein.
          Length = 185

 Score = 22.2 bits (45), Expect = 4.8
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +1

Query: 97  KIYYNILHINQL 132
           K+YYNI++I Q+
Sbjct: 111 KLYYNIINIEQI 122


>AY569720-1|AAS86673.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 22.2 bits (45), Expect = 4.8
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +1

Query: 97  KIYYNILHINQL 132
           K+YYNI++I Q+
Sbjct: 331 KLYYNIINIEQI 342


>AY569717-1|AAS86670.1|  397|Apis mellifera complementary sex
           determiner protein.
          Length = 397

 Score = 22.2 bits (45), Expect = 4.8
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +1

Query: 97  KIYYNILHINQL 132
           K+YYNI++I Q+
Sbjct: 322 KLYYNIINIEQI 333


>AY569712-1|AAS86665.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 22.2 bits (45), Expect = 4.8
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +1

Query: 97  KIYYNILHINQL 132
           K+YYNI++I Q+
Sbjct: 333 KLYYNIINIEQI 344


>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 22.2 bits (45), Expect = 4.8
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +1

Query: 97  KIYYNILHINQL 132
           K+YYNI++I Q+
Sbjct: 351 KLYYNIINIEQI 362


>AY569698-1|AAS86651.1|  407|Apis mellifera complementary sex
           determiner protein.
          Length = 407

 Score = 22.2 bits (45), Expect = 4.8
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +1

Query: 97  KIYYNILHINQL 132
           K+YYNI++I Q+
Sbjct: 335 KLYYNIINIEQI 346


>AY350617-1|AAQ57659.1|  428|Apis mellifera complementary sex
           determiner protein.
          Length = 428

 Score = 22.2 bits (45), Expect = 4.8
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +1

Query: 97  KIYYNILHINQL 132
           K+YYNI++I Q+
Sbjct: 353 KLYYNIINIEQI 364


>S78459-1|AAB34403.1|   50|Apis mellifera mast cell-degranulating
           peptide protein.
          Length = 50

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 9/30 (30%), Positives = 13/30 (43%)
 Frame = -1

Query: 220 SAFAITTTMFTLRCRRFIISRSTCRRMNSK 131
           S F   T      C+R +I    CR++  K
Sbjct: 19  SYFVTPTMSIKCNCKRHVIKPHICRKICGK 48


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 184,941
Number of Sequences: 438
Number of extensions: 3667
Number of successful extensions: 53
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 53
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 53
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20952180
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)