Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte24e11
         (666 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_01_0455 + 3582658-3583158,3584686-3584859,3585407-3585976           28   7.7  

>12_01_0455 + 3582658-3583158,3584686-3584859,3585407-3585976
          Length = 414

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 20/69 (28%), Positives = 29/69 (42%)
 Frame = +2

Query: 155 LVISQTKTMTSIL*RSPYSLRKGTIRASHGCCQTLELISPRQYQAARQGDSRQY*CSNEK 334
           L I  TKT + +  +  Y+L  G++    G     + I P     A +  S +   S  K
Sbjct: 301 LAIENTKTESYVTEKLFYALEAGSVPIYFGAPNVWDFIPPNSIIDASKFSSLRELASYVK 360

Query: 335 CVA*TPVRY 361
            VA  PV Y
Sbjct: 361 AVANDPVAY 369


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,665,519
Number of Sequences: 37544
Number of extensions: 230177
Number of successful extensions: 420
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 417
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 420
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1679486824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)