Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte23f02
         (649 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF032397-1|ABM97933.1|  200|Apis mellifera arginine kinase protein.    21   7.8  
DQ435326-1|ABD92641.1|  132|Apis mellifera OBP9 protein.               21   7.8  
AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.    21   7.8  

>EF032397-1|ABM97933.1|  200|Apis mellifera arginine kinase protein.
          Length = 200

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -3

Query: 464 FEKSDFHPAKKYG 426
           F+K+D HP K +G
Sbjct: 76  FKKTDKHPPKDFG 88


>DQ435326-1|ABD92641.1|  132|Apis mellifera OBP9 protein.
          Length = 132

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 11/40 (27%), Positives = 17/40 (42%)
 Frame = -1

Query: 481 ECFLPCSRNPISIQPKNTVLRCQKLLLKISSRMYVHTRTI 362
           +C+L C      I  KN  +  QK L  +   M   T+ +
Sbjct: 56  KCYLKCFMTKHGILDKNAEVDVQKALRHLPRSMQDSTKKL 95


>AF023619-1|AAC39040.1|  355|Apis mellifera arginine kinase protein.
          Length = 355

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -3

Query: 464 FEKSDFHPAKKYG 426
           F+K+D HP K +G
Sbjct: 92  FKKTDKHPPKDFG 104


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 182,931
Number of Sequences: 438
Number of extensions: 4086
Number of successful extensions: 6
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19560480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)