SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte22p13
         (646 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450 monoo...    23   1.9  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              23   3.3  
AY823258-1|AAX18443.1|  145|Apis mellifera pburs protein.              21   7.7  
AM420632-1|CAM06632.1|  145|Apis mellifera bursicon subunit beta...    21   7.7  

>DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 517

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = -1

Query: 202 YLMIYLTNEQLLHVTDHDSDVSLIACSTTSSTGLGF 95
           Y  + L NEQ    T HD  V+L +  T +ST LGF
Sbjct: 143 YTNLGLVNEQ--GQTWHDLRVALTSELTAASTVLGF 176


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 9/33 (27%), Positives = 18/33 (54%)
 Frame = +2

Query: 419  ENKSGSEDINDSSSLRNVDGTKGVDPQKIKLDD 517
            EN+ G+ D +D+ ++   +      P  I++DD
Sbjct: 955  ENEIGASDPSDTVTIITAEEAPSGPPTSIRVDD 987


>AY823258-1|AAX18443.1|  145|Apis mellifera pburs protein.
          Length = 145

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = -3

Query: 86  KHVTLHFCVD 57
           +H+TLH C D
Sbjct: 102 RHITLHHCYD 111


>AM420632-1|CAM06632.1|  145|Apis mellifera bursicon subunit beta
           protein precursor protein.
          Length = 145

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = -3

Query: 86  KHVTLHFCVD 57
           +H+TLH C D
Sbjct: 102 RHITLHHCYD 111


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 156,261
Number of Sequences: 438
Number of extensions: 2904
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19438227
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -