BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmte22i21
(711 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BC113658-1|AAI13659.1| 1686|Homo sapiens phosphoinositide-3-kina... 30 7.1
>BC113658-1|AAI13659.1| 1686|Homo sapiens phosphoinositide-3-kinase,
class 2, alpha polypeptide protein.
Length = 1686
Score = 30.3 bits (65), Expect = 7.1
Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
Frame = +1
Query: 73 RISGTPPH-RPIRNFVPKSDDL*KNGPIKILVPDNGNKCKI*PWKRHFIFIIQISSLGEI 249
R SG P + PI +F PK+ ++G IK + +K K P K H+I++++I G+I
Sbjct: 1397 RFSGLPSNDEPILSFSPKTYSFRQDGRIKEVSVFTYHK-KYNPDK-HYIYVVRILREGQI 1454
Query: 250 RTFFFY 267
F +
Sbjct: 1455 EPSFVF 1460
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 112,819,006
Number of Sequences: 237096
Number of extensions: 2708326
Number of successful extensions: 9302
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 9063
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9302
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8287202872
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -