SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte22b09
         (645 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.        23   2.5  
AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine rece...    21   7.7  

>AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.
          Length = 200

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 13/40 (32%), Positives = 16/40 (40%)
 Frame = +2

Query: 398 HHQMQIVADNPNWSVSLNPQPVAISLASFLRFHAVTKISV 517
           HHQ    + NP    +    P   SL S L   AV   +V
Sbjct: 14  HHQQLFSSANPGTIQACTTSPATASLESSLSAAAVAAAAV 53


>AY921573-1|AAX62923.1|  694|Apis mellifera D2-like dopamine
           receptor protein.
          Length = 694

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 6/13 (46%), Positives = 10/13 (76%)
 Frame = -1

Query: 531 CKPIITEILVTAW 493
           C+P +T  +VT+W
Sbjct: 652 CQPGVTAFIVTSW 664


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 168,051
Number of Sequences: 438
Number of extensions: 3454
Number of successful extensions: 10
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19438227
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -