Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte21c10
         (581 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.       73   2e-15
DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    21   8.9  

>DQ288391-1|ABC41341.1|  630|Apis mellifera vasa protein protein.
          Length = 630

 Score = 72.9 bits (171), Expect = 2e-15
 Identities = 32/69 (46%), Positives = 45/69 (65%)
 Frame = +2

Query: 353 LHANMQQRQRLKNLERFRDDKHGVLIATDVAARGLDIPDVDHVVHYQVPRTAESYVHRSG 532
           +H +  QRQR + L  F+  +  +L+AT VAARGLDI +V HV++Y +P+  + YVHR G
Sbjct: 481 IHGDRLQRQREEALADFKSGRMSILVATAVAARGLDIKNVSHVINYDLPKGIDEYVHRIG 540

Query: 533 RTARASKEG 559
           RT R    G
Sbjct: 541 RTGRVGNRG 549


>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -2

Query: 49  HLLAPHVRGQFVH 11
           H++AP VR  F+H
Sbjct: 335 HVMAPWVRRVFIH 347


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 157,799
Number of Sequences: 438
Number of extensions: 3223
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 16870914
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)