Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte21c02
         (607 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_0819 - 21529913-21530064,21531016-21531082,21531284-215313...    28   6.6  

>08_02_0819 -
           21529913-21530064,21531016-21531082,21531284-21531373,
           21531506-21531622,21532026-21532145,21532313-21533581
          Length = 604

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 18/73 (24%), Positives = 36/73 (49%), Gaps = 6/73 (8%)
 Frame = +2

Query: 206 LVLNYLWKSRAGLKARNEATN*------YTNCLKVAVLDKESDIDCLLSRKNISFLREAV 367
           LV NY+  +R G K+ ++  N       Y  CL+   ++  S+      + +I  +  +V
Sbjct: 370 LVFNYIVDARKGKKSASQFENIHQLRLLYNRCLQWQFVNARSEDTLTFQKSSIESILYSV 429

Query: 368 LLSLEKLRDTLEI 406
             S+ +LRD++ +
Sbjct: 430 WKSIVQLRDSVTV 442


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,557,413
Number of Sequences: 37544
Number of extensions: 231654
Number of successful extensions: 528
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 520
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 528
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1442939384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)