SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte1p14
         (756 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

S76957-1|AAB33932.1|  169|Apis mellifera olfactory receptor prot...    24   1.3  
DQ435338-1|ABD92653.1|  135|Apis mellifera OBP21 protein.              23   3.1  
DQ435334-1|ABD92649.1|  135|Apis mellifera OBP17 protein.              23   3.1  
DQ435332-1|ABD92647.1|  135|Apis mellifera OBP15 protein.              23   4.1  
DQ435335-1|ABD92650.1|  135|Apis mellifera OBP18 protein.              21   9.4  

>S76957-1|AAB33932.1|  169|Apis mellifera olfactory receptor
           protein.
          Length = 169

 Score = 24.2 bits (50), Expect = 1.3
 Identities = 13/35 (37%), Positives = 18/35 (51%)
 Frame = -1

Query: 111 FFIYIHISRF*ILNLHYNLNNFYAKSYPSLFRSYC 7
           FFIY+H S    L+L+  ++ FY    P L    C
Sbjct: 135 FFIYVHPSATFSLDLNKVVSVFYTAVIPMLNPFIC 169


>DQ435338-1|ABD92653.1|  135|Apis mellifera OBP21 protein.
          Length = 135

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +2

Query: 200 TISIIKAVCVCI 235
           TI II A+CVC+
Sbjct: 3   TIVIISAICVCV 14


>DQ435334-1|ABD92649.1|  135|Apis mellifera OBP17 protein.
          Length = 135

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +2

Query: 200 TISIIKAVCVCI 235
           TI II A+CVC+
Sbjct: 3   TIVIISAICVCV 14


>DQ435332-1|ABD92647.1|  135|Apis mellifera OBP15 protein.
          Length = 135

 Score = 22.6 bits (46), Expect = 4.1
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +2

Query: 200 TISIIKAVCVCI 235
           TI II A+C+C+
Sbjct: 3   TILIISAICICV 14


>DQ435335-1|ABD92650.1|  135|Apis mellifera OBP18 protein.
          Length = 135

 Score = 21.4 bits (43), Expect = 9.4
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 200 TISIIKAVCVCI 235
           T  II A+CVC+
Sbjct: 3   TFVIISAICVCV 14


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 224,111
Number of Sequences: 438
Number of extensions: 5366
Number of successful extensions: 12
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23753925
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -