BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmte18o14
(577 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. 25 0.41
>L10430-1|AAA27731.1| 150|Apis mellifera transposase protein.
Length = 150
Score = 25.4 bits (53), Expect = 0.41
Identities = 12/46 (26%), Positives = 22/46 (47%)
Frame = +3
Query: 39 IQRRLAWPLRKDDTQNREAFHIFAPRFLPLWWCGNRTVNYFKNLRP 176
I+R+ +W ++ Q I + L L W ++ + YF+ L P
Sbjct: 41 IKRKRSWSRPRESAQTTSKAGIHRKKVLLLVWWDHKGIVYFELLPP 86
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 162,771
Number of Sequences: 438
Number of extensions: 3445
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 16626408
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -