Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte18o11
         (580 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450 monoo...    21   8.8  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              21   8.8  
AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    21   8.8  

>DQ244075-1|ABB36785.1|  548|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 548

 Score = 21.0 bits (42), Expect = 8.8
 Identities = 11/37 (29%), Positives = 16/37 (43%)
 Frame = +3

Query: 114 MEKKLCEPCKEPIVDKLPPCPLMCKSPKCKAYMAPID 224
           +E K  E C    +   PP PL+ +  K    +A  D
Sbjct: 395 LEMKYLERCLLETLRMYPPVPLIAREIKTDLKLASGD 431


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.0 bits (42), Expect = 8.8
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -1

Query: 277  PFPDPGPPRTH 245
            P P P PPR H
Sbjct: 1857 PEPPPPPPRNH 1867


>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 21.0 bits (42), Expect = 8.8
 Identities = 7/13 (53%), Positives = 11/13 (84%)
 Frame = -3

Query: 404 ASFHNSGKAFRPL 366
           ++FHN+ +AF PL
Sbjct: 525 SAFHNAEEAFSPL 537


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 167,088
Number of Sequences: 438
Number of extensions: 3654
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 16748661
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)