BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmte18n07
(599 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPAC26H5.11 |||spore wall assembly protein |Schizosaccharomyces ... 25 6.4
>SPAC26H5.11 |||spore wall assembly protein |Schizosaccharomyces
pombe|chr 1|||Manual
Length = 965
Score = 25.4 bits (53), Expect = 6.4
Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
Frame = -1
Query: 194 C*WIKNRK*VCY-HFQLKVNFFFWLNLLIRCIFFS 93
C + KN+ +C +FQ + F W++++ R + FS
Sbjct: 370 CPYGKNKTLICLLNFQSSLLSFEWISIISRALLFS 404
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,455,687
Number of Sequences: 5004
Number of extensions: 22162
Number of successful extensions: 40
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 40
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 40
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 262236260
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -