Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte14g04
         (640 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450 monoo...    23   1.9  

>DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 499

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 2/65 (3%)
 Frame = -1

Query: 553 LGIADQLHPLPPHIVEVQS**WIYMVTSLK-IYHKFKNTARFLLYVTSQLPLFK*YNGLF 377
           LG+ ++  PL PH++ ++   W  + + L  I+   K    F L +   L L    + L 
Sbjct: 107 LGVFERTEPLSPHLLNLEVERWRPLRSRLSPIFTSGKLKEMFYLIIECSLNLETYLDKLI 166

Query: 376 -NNEP 365
             NEP
Sbjct: 167 EKNEP 171


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 157,102
Number of Sequences: 438
Number of extensions: 3050
Number of successful extensions: 16
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19193721
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)