SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte13p05
         (450 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ384991-1|ABD51779.1|   94|Apis mellifera allergen Api m 6 vari...    23   1.5  
DQ384990-1|ABD51778.1|   92|Apis mellifera allergen Api m 6 vari...    23   1.5  
AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    23   2.0  
Y13429-1|CAA73841.1|  402|Apis mellifera dopamine receptor, D1 p...    21   6.2  

>DQ384991-1|ABD51779.1|   94|Apis mellifera allergen Api m 6
          variant 2 precursor protein.
          Length = 94

 Score = 23.0 bits (47), Expect = 1.5
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +1

Query: 4  GPLGGRGACPA 36
          G LGGRG CP+
Sbjct: 29 GGLGGRGKCPS 39


>DQ384990-1|ABD51778.1|   92|Apis mellifera allergen Api m 6
          variant 1 precursor protein.
          Length = 92

 Score = 23.0 bits (47), Expect = 1.5
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +1

Query: 4  GPLGGRGACPA 36
          G LGGRG CP+
Sbjct: 29 GGLGGRGKCPS 39


>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 22.6 bits (46), Expect = 2.0
 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 1/49 (2%)
 Frame = -1

Query: 192 VSHLHYNAALFSASS-VCDMPGF*HVRFDFFILFCTHFLNQNFCRYLVC 49
           +S  H  A LF  S+ V    G   +    ++LF T  L  +FC  L C
Sbjct: 111 LSTAHLLAQLFLKSTEVTPRDGLGWLLLMLYLLFATLPLRLSFCVVLAC 159


>Y13429-1|CAA73841.1|  402|Apis mellifera dopamine receptor, D1
           protein.
          Length = 402

 Score = 21.0 bits (42), Expect = 6.2
 Identities = 8/25 (32%), Positives = 16/25 (64%)
 Frame = +1

Query: 112 KSYVSKPWHIADTRSTK*SGVVMQV 186
           K+  + P+H++D ++    GV+M V
Sbjct: 256 KTKPTSPYHVSDHKAAITVGVIMGV 280


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 90,439
Number of Sequences: 438
Number of extensions: 1527
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 11820384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -