Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte13o01
         (659 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex det...    29   0.052
AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cycl...    24   1.1  
DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               22   4.5  
DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chlor...    21   7.9  
DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chlor...    21   7.9  

>AY352277-1|AAQ67418.1|  418|Apis mellifera complementary sex
           determiner protein.
          Length = 418

 Score = 28.7 bits (61), Expect = 0.052
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 3/47 (6%)
 Frame = +1

Query: 373 KALENRTNMEDDRVAILEAQLS---QAKLIAEESDKKYEEVARKLVL 504
           K L N  N  D R    E +L    +A L+ +E +++YE++ RK++L
Sbjct: 16  KQLRNEDNKIDLRSRTKEERLQYRREAWLVQQEREQEYEKLKRKMIL 62


>AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cyclase
           beta-3 protein.
          Length = 832

 Score = 24.2 bits (50), Expect = 1.1
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +1

Query: 190 YHKRLQVEIMRRE 228
           YHK LQ+E++R E
Sbjct: 156 YHKELQIELVREE 168


>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 9/51 (17%), Positives = 24/51 (47%)
 Frame = +1

Query: 382 ENRTNMEDDRVAILEAQLSQAKLIAEESDKKYEEVARKLVLMEQDLERAEE 534
           + RT    DRV  LEA+      + ++  +  + +   L ++++ ++   +
Sbjct: 338 DRRTRHLSDRVVALEAEKKNLSKVIDQHSQLIDTLENVLAIVDRLMDETNQ 388


>DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -1

Query: 113 VPCCMFVVI 87
           +PCCM V++
Sbjct: 250 IPCCMLVIV 258


>DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -1

Query: 113 VPCCMFVVI 87
           +PCCM V++
Sbjct: 250 IPCCMLVIV 258


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.316    0.127    0.325 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 154,264
Number of Sequences: 438
Number of extensions: 4355
Number of successful extensions: 10
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19855845
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)