SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte13n03
         (463 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic ac...    22   2.8  
AY647436-1|AAU81605.1|  567|Apis mellifera juvenile hormone este...    21   4.9  
AY526235-1|AAS20468.1|  169|Apis mellifera esterase protein.           21   4.9  
AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein ...    21   4.9  
AB083009-1|BAC54130.1|  567|Apis mellifera esterase protein.           21   4.9  

>AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic
           acetylcholine Apisa7-2 subunit protein.
          Length = 461

 Score = 22.2 bits (45), Expect = 2.8
 Identities = 10/28 (35%), Positives = 14/28 (50%)
 Frame = -1

Query: 376 QLICLLSGIFQGSVSISF*FFPVAPSVC 293
           +++ L  GIF+ S  I   FFP     C
Sbjct: 118 EVVWLSHGIFRSSCDIDVEFFPFDEQRC 145


>AY647436-1|AAU81605.1|  567|Apis mellifera juvenile hormone
           esterase protein.
          Length = 567

 Score = 21.4 bits (43), Expect = 4.9
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -1

Query: 364 LLSGIFQGSVSIS 326
           L +G+FQG +SIS
Sbjct: 223 LSAGLFQGGISIS 235


>AY526235-1|AAS20468.1|  169|Apis mellifera esterase protein.
          Length = 169

 Score = 21.4 bits (43), Expect = 4.9
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -1

Query: 364 LLSGIFQGSVSIS 326
           L +G+FQG +SIS
Sbjct: 94  LSAGLFQGGISIS 106


>AJ276511-1|CAC06383.1|  352|Apis mellifera Antennapedia protein
           protein.
          Length = 352

 Score = 21.4 bits (43), Expect = 4.9
 Identities = 12/30 (40%), Positives = 16/30 (53%)
 Frame = +2

Query: 242 AEASANTEQPKKIVTFTTNRRSNWKKSERN 331
           A A   TE+  KI  +  NRR  WKK  ++
Sbjct: 304 AHALCLTERQIKI--WFQNRRMKWKKENKS 331


>AB083009-1|BAC54130.1|  567|Apis mellifera esterase protein.
          Length = 567

 Score = 21.4 bits (43), Expect = 4.9
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -1

Query: 364 LLSGIFQGSVSIS 326
           L +G+FQG +SIS
Sbjct: 223 LSAGLFQGGISIS 235


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 99,248
Number of Sequences: 438
Number of extensions: 1766
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12312900
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -