BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmte13e03
(597 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AK096949-1|BAC04909.1| 197|Homo sapiens protein ( Homo sapiens ... 29 9.5
>AK096949-1|BAC04909.1| 197|Homo sapiens protein ( Homo sapiens
cDNA FLJ39630 fis, clone SMINT2002202. ).
Length = 197
Score = 29.5 bits (63), Expect = 9.5
Identities = 18/51 (35%), Positives = 27/51 (52%)
Frame = +1
Query: 157 YTAVMDSLAESIADFIRVRQLNIAVAILLSVMYLAYQYWGVMFKCEEEEDY 309
YT V S+ I DF + ++ AV ILLS++ Y + + EEE+ Y
Sbjct: 130 YTYV--SVTGCIVDFQYLEVIHSAVQILLSLVGFVYACYVISISMEEEDTY 178
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 82,946,462
Number of Sequences: 237096
Number of extensions: 1654487
Number of successful extensions: 4665
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4488
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4665
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 6324506272
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -