BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmte12g16
(605 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 9.4
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.4
>DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel
protein.
Length = 463
Score = 21.0 bits (42), Expect = 9.4
Identities = 7/11 (63%), Positives = 8/11 (72%)
Frame = +1
Query: 121 FTKASVIYGWN 153
+TK VIY WN
Sbjct: 153 YTKRDVIYKWN 163
>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
Length = 1598
Score = 21.0 bits (42), Expect = 9.4
Identities = 10/31 (32%), Positives = 15/31 (48%), Gaps = 1/31 (3%)
Frame = -3
Query: 300 KHIVFRFPPGTEM-KPPAQKWPYLQFSYLCL 211
+++V F G+ PP + W L Y CL
Sbjct: 401 RNVVAPFLIGSRRTSPPPEDWKPLDKCYFCL 431
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,352
Number of Sequences: 438
Number of extensions: 3890
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17848938
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -