SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte12b03
         (680 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              24   1.5  
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso...    23   2.0  
AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic ac...    23   2.7  
DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex det...    22   6.2  
DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex det...    22   6.2  
DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex det...    22   6.2  
DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex det...    22   6.2  
DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex det...    22   6.2  
DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex det...    22   6.2  
DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex det...    22   6.2  
DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex det...    22   6.2  
DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex det...    22   6.2  
DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex det...    22   6.2  
AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex det...    22   6.2  
AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    22   6.2  

>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 10/25 (40%), Positives = 13/25 (52%)
 Frame = +1

Query: 73   RDSGQNKPSFNFVNNEQEDKEADCE 147
            R+  QN  SFN      E  EA+C+
Sbjct: 1865 RNHDQNNSSFNDSKESNEISEAECD 1889


>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
           protein.
          Length = 1770

 Score = 23.4 bits (48), Expect = 2.0
 Identities = 10/35 (28%), Positives = 19/35 (54%)
 Frame = +1

Query: 322 NFLGFDNPNILKLTKMKWLSENNDEALDSRKFNAL 426
           N++G ++  I ++  + W S N D  + S K  A+
Sbjct: 796 NYVGSEDSVIPRILYLTWYSSNGDIKVPSTKVLAM 830


>AY500239-1|AAR92109.1|  555|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha7-1 protein.
          Length = 555

 Score = 23.0 bits (47), Expect = 2.7
 Identities = 8/17 (47%), Positives = 9/17 (52%)
 Frame = +3

Query: 534 HI*EHALLPHHLHRVPV 584
           H   HA  PHH H  P+
Sbjct: 432 HHHSHAATPHHQHSTPL 448


>DQ325102-1|ABD14116.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = +2

Query: 485 NNNNYDEHKQIH 520
           NNNNY+ +K+++
Sbjct: 99  NNNNYNNYKKLY 110


>DQ325101-1|ABD14115.1|  182|Apis mellifera complementary sex
           determiner protein.
          Length = 182

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = +2

Query: 485 NNNNYDEHKQIH 520
           NNNNY+ +K+++
Sbjct: 99  NNNNYNNYKKLY 110


>DQ325100-1|ABD14114.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = +2

Query: 485 NNNNYDEHKQIH 520
           NNNNY+ +K+++
Sbjct: 99  NNNNYNNYKKLY 110


>DQ325099-1|ABD14113.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = +2

Query: 485 NNNNYDEHKQIH 520
           NNNNY+ +K+++
Sbjct: 99  NNNNYNNYKKLY 110


>DQ325098-1|ABD14112.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = +2

Query: 485 NNNNYDEHKQIH 520
           NNNNY+ +K+++
Sbjct: 99  NNNNYNNYKKLY 110


>DQ325097-1|ABD14111.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = +2

Query: 485 NNNNYDEHKQIH 520
           NNNNY+ +K+++
Sbjct: 99  NNNNYNNYKKLY 110


>DQ325096-1|ABD14110.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = +2

Query: 485 NNNNYDEHKQIH 520
           NNNNY+ +K+++
Sbjct: 99  NNNNYNNYKKLY 110


>DQ325095-1|ABD14109.1|  183|Apis mellifera complementary sex
           determiner protein.
          Length = 183

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = +2

Query: 485 NNNNYDEHKQIH 520
           NNNNY+ +K+++
Sbjct: 99  NNNNYNNYKKLY 110


>DQ325077-1|ABD14091.1|  181|Apis mellifera complementary sex
           determiner protein.
          Length = 181

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = +2

Query: 485 NNNNYDEHKQIH 520
           NNNNY+ +K+++
Sbjct: 97  NNNNYNNYKKLY 108


>DQ325076-1|ABD14090.1|  191|Apis mellifera complementary sex
           determiner protein.
          Length = 191

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = +2

Query: 485 NNNNYDEHKQIH 520
           NNNNY+ +K+++
Sbjct: 107 NNNNYNNYKKLY 118


>AY569704-1|AAS86657.1|  426|Apis mellifera complementary sex
           determiner protein.
          Length = 426

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = +2

Query: 485 NNNNYDEHKQIH 520
           NNNNY+ +K+++
Sbjct: 342 NNNNYNNYKKLY 353


>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 10/28 (35%), Positives = 14/28 (50%)
 Frame = +1

Query: 328 LGFDNPNILKLTKMKWLSENNDEALDSR 411
           LG+    I ++ K KW    N E L +R
Sbjct: 610 LGYQKGGISEIQKHKWFDGFNWEGLRAR 637


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 176,174
Number of Sequences: 438
Number of extensions: 3793
Number of successful extensions: 16
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20708550
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -