BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmte11k14
(335 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 3.0
AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 5.3
AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 20 9.2
>AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor
protein.
Length = 587
Score = 21.4 bits (43), Expect = 3.0
Identities = 10/49 (20%), Positives = 23/49 (46%)
Frame = -3
Query: 216 WLIISTKKFTSFSRTILKHNLLKILAFYGRDQIYEVLAPAVVMMVILSL 70
W++++ + ++ N+L ILA Y ++ V +V + + L
Sbjct: 64 WILVTLIVLAIVNVMVVLGNVLVILAVYHTSKLRNVTNMFIVSLAVADL 112
>AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein.
Length = 554
Score = 20.6 bits (41), Expect = 5.3
Identities = 5/9 (55%), Positives = 8/9 (88%)
Frame = +1
Query: 82 YHHHHRRSQ 108
+HHHH ++Q
Sbjct: 351 HHHHHHQTQ 359
>AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein.
Length = 200
Score = 19.8 bits (39), Expect = 9.2
Identities = 5/8 (62%), Positives = 7/8 (87%)
Frame = +1
Query: 85 HHHHRRSQ 108
HHHH++ Q
Sbjct: 98 HHHHQQQQ 105
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 75,401
Number of Sequences: 438
Number of extensions: 1222
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 50
effective length of database: 124,443
effective search space used: 7591023
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)
- SilkBase 1999-2023 -