SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte11k14
         (335 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor p...    21   3.0  
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                21   5.3  
AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.        20   9.2  

>AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor
           protein.
          Length = 587

 Score = 21.4 bits (43), Expect = 3.0
 Identities = 10/49 (20%), Positives = 23/49 (46%)
 Frame = -3

Query: 216 WLIISTKKFTSFSRTILKHNLLKILAFYGRDQIYEVLAPAVVMMVILSL 70
           W++++       +  ++  N+L ILA Y   ++  V    +V + +  L
Sbjct: 64  WILVTLIVLAIVNVMVVLGNVLVILAVYHTSKLRNVTNMFIVSLAVADL 112


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 20.6 bits (41), Expect = 5.3
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = +1

Query: 82  YHHHHRRSQ 108
           +HHHH ++Q
Sbjct: 351 HHHHHHQTQ 359


>AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.
          Length = 200

 Score = 19.8 bits (39), Expect = 9.2
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +1

Query: 85  HHHHRRSQ 108
           HHHH++ Q
Sbjct: 98  HHHHQQQQ 105


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 75,401
Number of Sequences: 438
Number of extensions: 1222
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 50
effective length of database: 124,443
effective search space used:  7591023
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2023 -