BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11j05 (707 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 2.1 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 23 2.8 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 5.0 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 5.0 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 22 6.6 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +3 Query: 138 DNDRTRIYKVVRFINRKPQKGSIQIDLTSRAKKTSKYTETERREAK 275 DNDR+RI ++ R K ++ S ++ ++T +T+ K Sbjct: 22 DNDRSRIARLGRDDGGKSRQSSFEVTSLLMREETEDAEDTQTLNLK 67 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -2 Query: 181 LMNLTTLYILVRSLSDISVLVIGTLTDLPFF 89 + T Y+ ++SD+ +LV+G +L F Sbjct: 71 MQTATNYYLFSLAISDLILLVLGLPNELSLF 101 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.2 bits (45), Expect = 5.0 Identities = 13/56 (23%), Positives = 24/56 (42%) Frame = +2 Query: 362 RVAGVFEEGELLTAHGGGEMGAYLPQSRNKTVLRSLGEHETGGRVERLRFER*RKD 529 ++ G+ E G G +GAY P+ K + + G+ + + + RKD Sbjct: 180 QLQGISTPVEAHLRKGRGAIGAYGPEKGPKVPEKKKEDEIDEGKESKTKLSQWRKD 235 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 5.0 Identities = 12/52 (23%), Positives = 20/52 (38%) Frame = +3 Query: 279 PPEIASGVDKKPDIKNSGSRRRFRRKQVASPASLRKASFSPPTEVAKWAPTC 434 PP + +P +N G + K++ S SL + V + TC Sbjct: 529 PPAKGAAAAGQPSKRNGGETNKQELKRLKSTVSLLPLPLARTPSVMSASSTC 580 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = +3 Query: 192 QKGSIQIDLTSRAKKTSKYTETE 260 ++GS+ + +TS+ + T+TE Sbjct: 398 ERGSMTVSVTSKPSTMERQTQTE 420 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,429 Number of Sequences: 438 Number of extensions: 3627 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -