BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11j01 (439 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30860.1 68417.m04381 SET domain-containing protein low simil... 32 0.19 At3g47060.1 68416.m05110 FtsH protease, putative contains simila... 27 4.2 >At4g30860.1 68417.m04381 SET domain-containing protein low similarity to IL-5 promoter REII-region-binding protein [Homo sapiens] GI:12642795; contains Pfam profile PF00856: SET domain Length = 497 Score = 31.9 bits (69), Expect = 0.19 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +2 Query: 182 CQHDFVPVCGQDSLGISRMFNDNCDLYE-YNCDEKKQYRHVKMDVCKYE 325 CQ + +C ++SLG S+ C +E + C ++ Q+R VK + ++ Sbjct: 141 CQGAYHSLCAKESLGFSKSSKFKCPQHECFVCKQRTQWRCVKCPMAAHD 189 >At3g47060.1 68416.m05110 FtsH protease, putative contains similarity to FtsH protease GI:13183728 from [Medicago sativa] Length = 802 Score = 27.5 bits (58), Expect = 4.2 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +2 Query: 188 HDFVPVCGQDSL---GISRMFNDNCDLYEYN 271 H F C +SL SR FND C +Y N Sbjct: 13 HGFATCCSSNSLLYSKASRFFNDRCRVYRQN 43 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,538,355 Number of Sequences: 28952 Number of extensions: 126519 Number of successful extensions: 258 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 258 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 692941200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -