BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11i23 (677 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_02_0015 + 10191793-10191957,10192085-10192229,10192331-101924... 28 7.9 >01_02_0015 + 10191793-10191957,10192085-10192229,10192331-10192419, 10193009-10193063,10193607-10193692,10194006-10194065 Length = 199 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +1 Query: 136 SVPRGTL*DRLHLRVPEAPRKMGSDLVLTKDEETALKDWCIALAECG 276 + P G L RL LR APR G+DLV + + + C E G Sbjct: 29 AAPSGGLPLRLRLRSSPAPRGHGADLVGAVELQAKVNSKCFFDVEVG 75 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,761,759 Number of Sequences: 37544 Number of extensions: 326009 Number of successful extensions: 681 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 681 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -