BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11i22 (765 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0340 - 16536571-16536705,16536820-16536951,16537265-165381... 29 5.4 06_03_0635 - 22971502-22973840,22974112-22974403,22974639-229751... 29 5.4 >11_04_0340 - 16536571-16536705,16536820-16536951,16537265-16538106, 16538480-16538940,16539032-16540314,16540423-16541627, 16541857-16542157 Length = 1452 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = +2 Query: 458 GNMLLPSTGAMRN*SKRSHLVADARKHF 541 GN+ +P+ AM N K HL+ADA+ HF Sbjct: 670 GNISVPA--AMNNLVKLRHLIADAKVHF 695 >06_03_0635 - 22971502-22973840,22974112-22974403,22974639-22975162, 22975314-22975583,22976393-22977124,22977226-22977310 Length = 1413 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -3 Query: 601 LLYIDNTHKLVIDEQLKHSTKMFAGVGH*MASLR 500 LL + HKL++D + HSTK ++ H + +LR Sbjct: 741 LLNKSHLHKLILDWNVNHSTKDYSQEEHILENLR 774 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,385,951 Number of Sequences: 37544 Number of extensions: 316420 Number of successful extensions: 460 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2051430072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -