BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11i20 (717 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 32 0.40 SB_52615| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_384| Best HMM Match : IBR (HMM E-Value=1.1e-12) 29 2.8 SB_31156| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_38688| Best HMM Match : TP901-1_ORF40 (HMM E-Value=1.7) 28 6.6 SB_34614| Best HMM Match : FMO-like (HMM E-Value=0) 28 6.6 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 32.3 bits (70), Expect = 0.40 Identities = 19/83 (22%), Positives = 39/83 (46%) Frame = +3 Query: 360 DRGKVALISCPTLFVPLKRQIGDRGTVTLLEYDRRFEVHGPDYIFYDYNNPKEVPPDVHH 539 DR V +++ P + +I DR V + + D + +H P +++ + PP V+H Sbjct: 531 DRKNVIVVNRPPMIYHPPPEIYDRPDVVVHQPD--YVIHRPSVVYHQPSVVVHRPPIVYH 588 Query: 540 SYDLVVADPPFLSEECITKTSET 608 +V PP + + + + +T Sbjct: 589 QPPVVFHQPPPMVRQPVMHSHDT 611 Score = 29.5 bits (63), Expect = 2.8 Identities = 22/95 (23%), Positives = 40/95 (42%) Frame = +3 Query: 324 HSLVKVIDKVLDDRGKVALISCPTLFVPLKRQIGDRGTVTLLEYDRRFEVHGPDYIFYDY 503 +S K DK D+ ++ P + +I DR V + D VH P +++ Sbjct: 680 NSTAKKSDK--GDKKNTVIVQRPPMIYHPPPEIYDRPDVVVHRPD--LVVHRPSIVYHQP 735 Query: 504 NNPKEVPPDVHHSYDLVVADPPFLSEECITKTSET 608 + PP ++H ++ PP L + + + ET Sbjct: 736 SVVVHRPPIIYHQPPVMFHQPPPLVHQPVLHSHET 770 >SB_52615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1154 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -3 Query: 340 TLTRECTVFSSYQN*LSCQFSSNKIFSVNFLSASSF 233 T+T C VF N LSC+ IF V FL+ F Sbjct: 853 TMTFTCFVFFDMFNALSCRSQEKSIFQVGFLTNRMF 888 >SB_384| Best HMM Match : IBR (HMM E-Value=1.1e-12) Length = 259 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 182 SKCLC*QCGHVFICFHCTKRCSFSLTL 102 ++ +C C H+F C+HC K FS+ L Sbjct: 199 AQMMCGNCKHIF-CWHCLKGLDFSVDL 224 >SB_31156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -1 Query: 675 PLLYPSLWYRCIKLFYLSKAI*LSPMFLLC-ILQKGMVGRPLLN 547 PL P++ C+KL+Y + + F+L Q G+ G P LN Sbjct: 30 PLFEPTMTSACMKLYYPCSSATMDSCFVLFRTCQHGIAGLPQLN 73 >SB_38688| Best HMM Match : TP901-1_ORF40 (HMM E-Value=1.7) Length = 576 Score = 28.3 bits (60), Expect = 6.6 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +3 Query: 420 IGDRGTVTLLEYDRRFEVHGPDYI--FYDYNNPKEVPPDVHHSYDL 551 +G R ++L+ D RF+ YI ++DYN+ K+ P SY + Sbjct: 456 VGIRYQLSLMRGDIRFKPDSAKYIPVYFDYNSSKKEVPKFLSSYTI 501 >SB_34614| Best HMM Match : FMO-like (HMM E-Value=0) Length = 475 Score = 28.3 bits (60), Expect = 6.6 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +3 Query: 492 FYDYNNPKEVPPDVHHSY 545 F D+ PK+ PP +HHSY Sbjct: 65 FSDFPIPKDYPPFMHHSY 82 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,255,352 Number of Sequences: 59808 Number of extensions: 402321 Number of successful extensions: 1149 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1147 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -