BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11i10 (726 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 24 1.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 3.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 5.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 5.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 5.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 5.8 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 7.7 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = -3 Query: 184 EQLVHQHLSLHPLSQRH*QLQDFPHFSFQHLPLEP 80 + L H + S R PHF++ H PL P Sbjct: 74 QDLQHSYQSPQTQPARFYSTPIVPHFAYNHNPLTP 108 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 565 LDLIAAKCYFYHSRVFELT 621 LD IA CY YH + ++T Sbjct: 2007 LDWIAVMCYDYHGQWDKIT 2025 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -3 Query: 112 HFSFQHLPLEPLYI*LIFF 56 H S ++L LEP+ + +FF Sbjct: 1315 HISKEYLQLEPIGLVFVFF 1333 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -3 Query: 112 HFSFQHLPLEPLYI*LIFF 56 H S ++L LEP+ + +FF Sbjct: 1315 HISKEYLQLEPIGLVFVFF 1333 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -3 Query: 112 HFSFQHLPLEPLYI*LIFF 56 H S ++L LEP+ + +FF Sbjct: 1315 HISKEYLQLEPIGLVFVFF 1333 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -3 Query: 112 HFSFQHLPLEPLYI*LIFF 56 H S ++L LEP+ + +FF Sbjct: 1315 HISKEYLQLEPIGLVFVFF 1333 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 211 FV*CVLVDPEQLVHQHL 161 F+ CV+V EQ+ HL Sbjct: 616 FIICVIVQSEQIAWLHL 632 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +2 Query: 182 FRIYENTSDKSIKLLLR 232 F +YE SD+ IKL+++ Sbjct: 1139 FCVYEFASDERIKLVIK 1155 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,610 Number of Sequences: 336 Number of extensions: 3132 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -