BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11i10 (726 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25516| Best HMM Match : AAA_2 (HMM E-Value=0) 35 0.077 SB_53718| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_25516| Best HMM Match : AAA_2 (HMM E-Value=0) Length = 609 Score = 34.7 bits (76), Expect = 0.077 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 2/97 (2%) Frame = +1 Query: 172 VLAVQDLREHIRQIDKAVTSKEPRFAMRVLRALPSTRRKLNGNVLRAIINQIYPASAEKE 351 VL+ D + HIRQ KA + P A + R P RK+ + R +I Q Y A+K Sbjct: 125 VLSDSDSKRHIRQDSKASLNNGPEKAAKTSRKPPPPPRKIFDYLDRYVIGQDY---AKKV 181 Query: 352 TILSFVENPLPGAVEIEAPRSRSAPKQ--PVPEVDTY 456 ++ + +V I++ S P + P+P Y Sbjct: 182 LAVAVYNHYKRLSVNIKSSSQNSVPAEVKPIPLTRPY 218 >SB_53718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 8.9 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 4/41 (9%) Frame = +1 Query: 88 VEDVE----MKNVESPAAVSDVETADVKKDADVLAVQDLRE 198 VEDV+ +K+V++ V DV ADV KD D A D+ E Sbjct: 114 VEDVDAGDVVKDVDAADDVEDVNAADVVKDVD--AADDVEE 152 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,029,007 Number of Sequences: 59808 Number of extensions: 386845 Number of successful extensions: 986 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 885 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 982 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -