BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11i09 (625 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 26 0.34 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 26 0.34 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 24 1.4 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 2.4 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 22 5.6 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 22 5.6 AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 22 5.6 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 21 7.4 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 21 7.4 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 21 7.4 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 21 7.4 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 7.4 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 7.4 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 7.4 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 7.4 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 7.4 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 7.4 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 9.8 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 9.8 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 9.8 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 25.8 bits (54), Expect = 0.34 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +3 Query: 384 EPEEKQLEKVETDQNYANVETEQKETPALPRNEVIKRLRERGHPILLF 527 EP E EK+ET N T + P ++ R ++ G P LF Sbjct: 572 EPSEIFYEKIETSLNSDKPFTYNERIFGFPGRLLLPRGKKEGMPFQLF 619 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 25.8 bits (54), Expect = 0.34 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +3 Query: 384 EPEEKQLEKVETDQNYANVETEQKETPALPRNEVIKRLRERGHPILLF 527 EP E EK+ET N T + P ++ R ++ G P LF Sbjct: 572 EPSEIFYEKIETSLNSDKPFTYNERIFGFPGRLLLPRGKKEGMPFQLF 619 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 499 EKEVIQYYCLLKLKFSPLRD*EELKFKNQKLTGASGMTSKKR 624 EKE + + ++S R+ E+ +KN++ G TSK+R Sbjct: 247 EKEKLLEERTSRKRYSRSREREQKSYKNEREYRKYGKTSKER 288 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.0 bits (47), Expect = 2.4 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 499 EKEVIQYYCLLKLKFSPLRD*EELKFKNQKLTGASGMTSKKR 624 EKE + + ++S R+ E+ +KN++ G TSK+R Sbjct: 258 EKEKLLEERTSRERYSRSREREQKSYKNEREYRKYGETSKER 299 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 21.8 bits (44), Expect = 5.6 Identities = 15/66 (22%), Positives = 30/66 (45%) Frame = +3 Query: 228 MNSLQIHIKVKKEYLIPLLHQDPSNKKKYFKRGELLAKEQEEYLRKYGPKVQEPEEKQLE 407 ++S K+ + ++ L+ P NK + + +YLR+Y + PE+ L Sbjct: 76 LSSFYDRTKMSLQLVLAALY--PPNKLQQWNEDLNWQPIATKYLRRYEDNIFLPEDCLLF 133 Query: 408 KVETDQ 425 +E D+ Sbjct: 134 TIELDR 139 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 21.8 bits (44), Expect = 5.6 Identities = 15/66 (22%), Positives = 30/66 (45%) Frame = +3 Query: 228 MNSLQIHIKVKKEYLIPLLHQDPSNKKKYFKRGELLAKEQEEYLRKYGPKVQEPEEKQLE 407 ++S K+ + ++ L+ P NK + + +YLR+Y + PE+ L Sbjct: 91 LSSFYDRTKMSLQLVLAALY--PPNKLQQWNEDLNWQPIATKYLRRYEDNIFLPEDCLLF 148 Query: 408 KVETDQ 425 +E D+ Sbjct: 149 TIELDR 154 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 21.8 bits (44), Expect = 5.6 Identities = 18/53 (33%), Positives = 23/53 (43%) Frame = +3 Query: 318 KRGELLAKEQEEYLRKYGPKVQEPEEKQLEKVETDQNYANVETEQKETPALPR 476 KRG L + +EE L K K E K + Q +A VE +E A R Sbjct: 124 KRGAKLTEAEEEVLNKKRSKKAE------AKYKARQRFAKVEPALEEQFATGR 170 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 538 KFSPLRD*EELKFKNQKLTGASGMTSKKR 624 ++S R+ E+ +KN++ G TSK+R Sbjct: 38 RYSRSREREQKLYKNEREYRKYGETSKER 66 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 538 KFSPLRD*EELKFKNQKLTGASGMTSKKR 624 ++S R+ E+ +KN++ G TSK+R Sbjct: 38 RYSRSREREQKLYKNEREYRKYGETSKER 66 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 538 KFSPLRD*EELKFKNQKLTGASGMTSKKR 624 ++S R+ E+ +KN++ G TSK+R Sbjct: 38 RYSRSREREQKLYKNEREYRKYGETSKER 66 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 538 KFSPLRD*EELKFKNQKLTGASGMTSKKR 624 ++S R+ E+ +KN++ G TSK+R Sbjct: 38 RYSRSREREQKLYKNEREYRKYGETSKER 66 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 538 KFSPLRD*EELKFKNQKLTGASGMTSKKR 624 ++S R+ E+ +KN++ G TSK+R Sbjct: 271 RYSRSREREQKLYKNEREYRKYGETSKER 299 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 538 KFSPLRD*EELKFKNQKLTGASGMTSKKR 624 ++S R+ E+ +KN++ G TSK+R Sbjct: 271 RYSRSREREQKLYKNEREYRKYGETSKER 299 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 538 KFSPLRD*EELKFKNQKLTGASGMTSKKR 624 ++S R+ E+ +KN++ G TSK+R Sbjct: 271 RYSRSREREQKLYKNEREYRKYGETSKER 299 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 538 KFSPLRD*EELKFKNQKLTGASGMTSKKR 624 ++S R+ E+ +KN++ G TSK+R Sbjct: 271 RYSRSREREQKLYKNEREYRKYGETSKER 299 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 538 KFSPLRD*EELKFKNQKLTGASGMTSKKR 624 ++S R+ E+ +KN++ G TSK+R Sbjct: 271 RYSRSREREQKLYKNEREYRKYGETSKER 299 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 538 KFSPLRD*EELKFKNQKLTGASGMTSKKR 624 ++S R+ E+ +KN++ G TSK+R Sbjct: 260 RYSRSREREQKLYKNEREYRKYGETSKER 288 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.0 bits (42), Expect = 9.8 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +1 Query: 499 EKEVIQYYCLLKLKFSPLRD*EELKFKNQKLTGASGMTSKKR 624 EKE + + ++S R+ E+ +KN+K TSK+R Sbjct: 25 EKEKLLEERTSRKRYSRSREREQNSYKNEKEYRKYRETSKER 66 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = -1 Query: 154 LLIVVHSTYKSIS*IKMKILQFLKNTAVL 68 L+ +VH + I+ + I+Q +KN +L Sbjct: 344 LMKIVHEKQQEITGLIQNIIQEMKNDVLL 372 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = -1 Query: 154 LLIVVHSTYKSIS*IKMKILQFLKNTAVL 68 L+ +VH + I+ + I+Q +KN +L Sbjct: 382 LMKIVHEKQQEITGLIQNIIQEMKNDVLL 410 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,608 Number of Sequences: 438 Number of extensions: 3030 Number of successful extensions: 20 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -