BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11i08 (710 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08560.1 68417.m01408 pumilio/Puf RNA-binding domain-containi... 30 1.7 At1g13810.1 68414.m01621 expressed protein ; expression supporte... 28 7.0 >At4g08560.1 68417.m01408 pumilio/Puf RNA-binding domain-containing protein low similarity to RNA binding protein PufA [Dictyostelium discoideum] GI:5106561; contains Pfam profile PF00806: Pumilio-family RNA binding repeat Length = 477 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +2 Query: 386 CY-TGTTKSLFALWQTVKFQIRIKNDEFRQYLGSNPEDVYKEYTKDSYGWSVVNPFIKKS 562 CY T T KSL V++ +R+K+ E L + + Y + + D YG VV ++ Sbjct: 346 CYGTLTPKSLLVRNYVVQYLLRLKDYEVTSALSKHLDGNYVQLSYDKYGSHVVQKCLESR 405 Query: 563 Q 565 + Sbjct: 406 E 406 >At1g13810.1 68414.m01621 expressed protein ; expression supported by MPSS Length = 303 Score = 27.9 bits (59), Expect = 7.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 374 IDIYCYTGTTKSLFALWQTVKF 439 +D+YC+T SLF +W+ F Sbjct: 208 LDLYCWTRNGSSLFRVWRDTAF 229 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,387,143 Number of Sequences: 28952 Number of extensions: 278238 Number of successful extensions: 690 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 690 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1535986264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -