BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11h17 (718 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y10129-1|CAA71216.1| 1274|Homo sapiens myosin binding protein C ... 30 7.2 X84075-1|CAA58882.1| 1274|Homo sapiens cardiac myosin-binding pr... 30 7.2 U91629-1|AAC04620.1| 1274|Homo sapiens cardiac myosin binding pr... 30 7.2 EF560722-1|ABQ59032.1| 1274|Homo sapiens MYBPC3 protein protein. 30 7.2 BC151211-1|AAI51212.1| 1274|Homo sapiens myosin binding protein ... 30 7.2 BC142685-1|AAI42686.1| 1274|Homo sapiens myosin binding protein ... 30 7.2 AY518390-1|AAR89909.1| 1273|Homo sapiens myosin binding protein ... 30 7.2 AF430677-1|AAL26614.1| 126|Homo sapiens T cell receptor beta va... 30 7.2 U58515-1|AAB04534.1| 424|Homo sapiens chitinase protein. 30 9.5 U58514-1|AAB04533.1| 390|Homo sapiens chitinase precursor protein. 30 9.5 U49835-1|AAC50597.1| 385|Homo sapiens YKL-39 precursor protein. 30 9.5 BT006767-1|AAP35413.1| 390|Homo sapiens chitinase 3-like 2 prot... 30 9.5 BC011460-1|AAH11460.1| 390|Homo sapiens chitinase 3-like 2 prot... 30 9.5 AL513202-1|CAH70799.1| 390|Homo sapiens chitinase 3-like 2 prot... 30 9.5 AK223316-1|BAD97036.1| 378|Homo sapiens chitinase 3-like 2 vari... 30 9.5 >Y10129-1|CAA71216.1| 1274|Homo sapiens myosin binding protein C gene protein. Length = 1274 Score = 30.3 bits (65), Expect = 7.2 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 524 CNMSIKLHFLDSHVDFFP 577 CN+S KLHF++ +DF P Sbjct: 623 CNLSAKLHFMEVKIDFVP 640 >X84075-1|CAA58882.1| 1274|Homo sapiens cardiac myosin-binding protein C protein. Length = 1274 Score = 30.3 bits (65), Expect = 7.2 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 524 CNMSIKLHFLDSHVDFFP 577 CN+S KLHF++ +DF P Sbjct: 623 CNLSAKLHFMEVKIDFVP 640 >U91629-1|AAC04620.1| 1274|Homo sapiens cardiac myosin binding protein-C protein. Length = 1274 Score = 30.3 bits (65), Expect = 7.2 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 524 CNMSIKLHFLDSHVDFFP 577 CN+S KLHF++ +DF P Sbjct: 623 CNLSAKLHFMEVKIDFVP 640 >EF560722-1|ABQ59032.1| 1274|Homo sapiens MYBPC3 protein protein. Length = 1274 Score = 30.3 bits (65), Expect = 7.2 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 524 CNMSIKLHFLDSHVDFFP 577 CN+S KLHF++ +DF P Sbjct: 623 CNLSAKLHFMEVKIDFVP 640 >BC151211-1|AAI51212.1| 1274|Homo sapiens myosin binding protein C, cardiac protein. Length = 1274 Score = 30.3 bits (65), Expect = 7.2 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 524 CNMSIKLHFLDSHVDFFP 577 CN+S KLHF++ +DF P Sbjct: 623 CNLSAKLHFMEVKIDFVP 640 >BC142685-1|AAI42686.1| 1274|Homo sapiens myosin binding protein C, cardiac protein. Length = 1274 Score = 30.3 bits (65), Expect = 7.2 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 524 CNMSIKLHFLDSHVDFFP 577 CN+S KLHF++ +DF P Sbjct: 623 CNLSAKLHFMEVKIDFVP 640 >AY518390-1|AAR89909.1| 1273|Homo sapiens myosin binding protein C, cardiac protein. Length = 1273 Score = 30.3 bits (65), Expect = 7.2 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 524 CNMSIKLHFLDSHVDFFP 577 CN+S KLHF++ +DF P Sbjct: 622 CNLSAKLHFMEVKIDFVP 639 >AF430677-1|AAL26614.1| 126|Homo sapiens T cell receptor beta variable region protein. Length = 126 Score = 30.3 bits (65), Expect = 7.2 Identities = 18/55 (32%), Positives = 26/55 (47%) Frame = -2 Query: 465 LLFPRKLLTTSLNASQASDSVLFIVASKFSSAIKDLICGPSNTPLIFASDNLGIF 301 L FP ++NA + DS L++ AS F A + GP T L+ D +F Sbjct: 56 LQFPNYSSELNVNALELDDSALYLCASSFQGARETQYFGP-GTRLLVLEDLKNVF 109 >U58515-1|AAB04534.1| 424|Homo sapiens chitinase protein. Length = 424 Score = 29.9 bits (64), Expect = 9.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 620 YQDIKTMETRYQCRWNVNMMADYCWSLTND 709 Y D+K+MET+ Q N+N+ WS+ D Sbjct: 370 YDDVKSMETKVQFLKNLNLGGAMIWSIDMD 399 >U58514-1|AAB04533.1| 390|Homo sapiens chitinase precursor protein. Length = 390 Score = 29.9 bits (64), Expect = 9.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 620 YQDIKTMETRYQCRWNVNMMADYCWSLTND 709 Y D+K+MET+ Q N+N+ WS+ D Sbjct: 336 YDDVKSMETKVQFLKNLNLGGAMIWSIDMD 365 >U49835-1|AAC50597.1| 385|Homo sapiens YKL-39 precursor protein. Length = 385 Score = 29.9 bits (64), Expect = 9.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 620 YQDIKTMETRYQCRWNVNMMADYCWSLTND 709 Y D+K+MET+ Q N+N+ WS+ D Sbjct: 331 YDDVKSMETKVQFLKNLNLGGAMIWSIDMD 360 >BT006767-1|AAP35413.1| 390|Homo sapiens chitinase 3-like 2 protein. Length = 390 Score = 29.9 bits (64), Expect = 9.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 620 YQDIKTMETRYQCRWNVNMMADYCWSLTND 709 Y D+K+MET+ Q N+N+ WS+ D Sbjct: 336 YDDVKSMETKVQFLKNLNLGGAMIWSIDMD 365 >BC011460-1|AAH11460.1| 390|Homo sapiens chitinase 3-like 2 protein. Length = 390 Score = 29.9 bits (64), Expect = 9.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 620 YQDIKTMETRYQCRWNVNMMADYCWSLTND 709 Y D+K+MET+ Q N+N+ WS+ D Sbjct: 336 YDDVKSMETKVQFLKNLNLGGAMIWSIDMD 365 >AL513202-1|CAH70799.1| 390|Homo sapiens chitinase 3-like 2 protein. Length = 390 Score = 29.9 bits (64), Expect = 9.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 620 YQDIKTMETRYQCRWNVNMMADYCWSLTND 709 Y D+K+MET+ Q N+N+ WS+ D Sbjct: 336 YDDVKSMETKVQFLKNLNLGGAMIWSIDMD 365 >AK223316-1|BAD97036.1| 378|Homo sapiens chitinase 3-like 2 variant protein. Length = 378 Score = 29.9 bits (64), Expect = 9.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 620 YQDIKTMETRYQCRWNVNMMADYCWSLTND 709 Y D+K+MET+ Q N+N+ WS+ D Sbjct: 324 YDDVKSMETKVQFLKNLNLGGAMIWSIDMD 353 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,579,151 Number of Sequences: 237096 Number of extensions: 1732364 Number of successful extensions: 3562 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 3432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3562 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8399192100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -