BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11g22 (734 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 45 9e-07 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 23 3.0 AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced prot... 21 9.1 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 9.1 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 44.8 bits (101), Expect = 9e-07 Identities = 46/166 (27%), Positives = 76/166 (45%), Gaps = 14/166 (8%) Frame = +1 Query: 145 NNPR--KIKYDDILAASRRIVGAVVRTPCTRAH---MSERLGMDIYFKQEFLQYTGSFKE 309 N+P + K D I+ A+ +TP + + S + +IY K EFL GS K+ Sbjct: 20 NSPHTCRTKNGDYTKIMPDILTAIGQTPLIKLNNIPKSYGIKCEIYAKCEFLNPGGSVKD 79 Query: 310 RGVRNALISLSDEQK-KNG--VIAASTGNHGAALSYHSTQLGIPCIVVVPIHTALNKVNK 480 R + D+ K G +I ++GN G L+ + G CI+V+P + K++ Sbjct: 80 RIAYRMIQDAEDKGLLKPGCTIIEPTSGNTGIGLAMAAAVRGYKCIIVMPEKMSDEKIST 139 Query: 481 CEQLGAKVFKHGIDMS--AAKLH---AMSLGKE-KKMIYINGYDHP 600 LGAK+ + + S + + H A L KE I ++ Y +P Sbjct: 140 LYALGAKIIRTPTEASWHSPEAHISVAQKLQKEIPNSIILDQYTNP 185 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 91 NLQIKMSVDIEFDENCDPNNPRKIKYDDI 177 N ++ + E + C P N +++KYDDI Sbjct: 323 NQDVQKKLREEINTFC-PKNNKELKYDDI 350 >AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced protein 75 protein. Length = 87 Score = 21.4 bits (43), Expect = 9.1 Identities = 6/22 (27%), Positives = 12/22 (54%) Frame = +3 Query: 54 FKTCFYNENLQLKLANQNECRY 119 ++ C N+ + N+N C+Y Sbjct: 52 YRPCTKNQQCSILRINRNRCQY 73 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 9.1 Identities = 6/22 (27%), Positives = 12/22 (54%) Frame = +3 Query: 54 FKTCFYNENLQLKLANQNECRY 119 ++ C N+ + N+N C+Y Sbjct: 101 YRPCTKNQQCSILRINRNRCQY 122 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,950 Number of Sequences: 438 Number of extensions: 5010 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -