BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11g13 (365 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q1FMZ4 Cluster: Putative uncharacterized protein precur... 31 8.6 UniRef50_A6EA62 Cluster: Alpha-L-rhamnosidase; n=1; Pedobacter s... 31 8.6 >UniRef50_Q1FMZ4 Cluster: Putative uncharacterized protein precursor; n=1; Clostridium phytofermentans ISDg|Rep: Putative uncharacterized protein precursor - Clostridium phytofermentans ISDg Length = 772 Score = 30.7 bits (66), Expect = 8.6 Identities = 18/64 (28%), Positives = 34/64 (53%) Frame = +3 Query: 75 FLLIM*LCLYKILLFML*KAVFQSGFFSMIYINVNGFQTKNKSQIRIQLSAVLFESD*FK 254 FL ++ CLY ++L ++ +F + F +IY+ + G K + I + +LF + F Sbjct: 694 FLCLLLECLYYVILAVMISILFGTICFKIIYL-IIGMDVKMQFSSIIGMGLILFLTTIFT 752 Query: 255 AFLI 266 FL+ Sbjct: 753 NFLV 756 >UniRef50_A6EA62 Cluster: Alpha-L-rhamnosidase; n=1; Pedobacter sp. BAL39|Rep: Alpha-L-rhamnosidase - Pedobacter sp. BAL39 Length = 792 Score = 30.7 bits (66), Expect = 8.6 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +2 Query: 170 KCQWLPDEKQITNSYPII 223 K +WL D+K++TN+YP++ Sbjct: 272 KVEWLIDQKELTNAYPVL 289 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 279,617,505 Number of Sequences: 1657284 Number of extensions: 4729445 Number of successful extensions: 7789 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7701 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7789 length of database: 575,637,011 effective HSP length: 90 effective length of database: 426,481,451 effective search space used: 13220924981 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -