BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11g13 (365 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb... 27 0.91 SPBC16D10.04c |dna2||DNA replication endonuclease-helicase Dna2|... 26 2.1 SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizos... 24 6.4 SPAPB1A10.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 24 8.5 SPAC227.15 |||protein phosphatase regulatory subunit Reg1 |Schiz... 24 8.5 >SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 2685 Score = 27.1 bits (57), Expect = 0.91 Identities = 10/33 (30%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 134 GLSEWIFLHDLHKCQW-LPDEKQITNSYPIISS 229 G + W+ + D H+ W LP + + + YP+ S Sbjct: 1663 GPANWVDIDDYHEADWLLPQQNEKCSIYPLAFS 1695 >SPBC16D10.04c |dna2||DNA replication endonuclease-helicase Dna2|Schizosaccharomyces pombe|chr 2|||Manual Length = 1398 Score = 25.8 bits (54), Expect = 2.1 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +1 Query: 193 KTNHKFVSNYQQCSLKVISSKHS*YEI 273 K N F NY+ L I S H+ Y I Sbjct: 853 KKNQVFFGNYEDSKLSFIGSNHTRYRI 879 >SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizosaccharomyces pombe|chr 1|||Manual Length = 927 Score = 24.2 bits (50), Expect = 6.4 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = -2 Query: 283 LQVKFRIKNALN*SLSKSTADNWIRICDLF 194 + ++R N L ++++ D W +CD F Sbjct: 196 MDAEYRETNELLLTVTREWIDRWTEVCDAF 225 >SPAPB1A10.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 412 Score = 23.8 bits (49), Expect = 8.5 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -1 Query: 323 QLVFLSLPAVTFTTT 279 QL++L PAVTF+T+ Sbjct: 392 QLIYLPKPAVTFSTS 406 >SPAC227.15 |||protein phosphatase regulatory subunit Reg1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 873 Score = 23.8 bits (49), Expect = 8.5 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = -2 Query: 292 RSLLQVKFRIKNALN*SLSKSTADNWIRICDLFFVWKPL 176 R+ ++ KF++K ++S T NW++ CD+ +++ PL Sbjct: 337 RTWMKHKFKLK-----TISPETL-NWLKECDVTWLYGPL 369 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,253,127 Number of Sequences: 5004 Number of extensions: 22327 Number of successful extensions: 47 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 114084208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -