BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11g11 (688 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 23 2.7 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 22 6.3 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 22 6.3 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 22 6.3 AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 22 6.3 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 6.3 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 22 6.3 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 8.3 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.0 bits (47), Expect = 2.7 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +2 Query: 8 KFEIMADIDIR-DLRKQCIQSLISTAENVAKYLQEDKEDNYEKLKMYM 148 KF+ + + D + DLR + + + A +Q+++E YEKLK M Sbjct: 14 KFKQLRNEDNKIDLRSRTKEERLQYRRE-AWLVQQEREQEYEKLKRKM 60 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 290 INPNSHRYMQELKTRYES 343 I PN++R+ L R+ES Sbjct: 157 IPPNAYRFRPSLNPRFES 174 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 290 INPNSHRYMQELKTRYES 343 I PN++R+ L R+ES Sbjct: 157 IPPNAYRFRPSLNPRFES 174 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 290 INPNSHRYMQELKTRYES 343 I PN++R+ L R+ES Sbjct: 157 IPPNAYRFRPSLNPRFES 174 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 107 LANI*RHFPQSRLSFEY 57 LAN+ R+FP L+F + Sbjct: 77 LANVIRYFPTQALNFAF 93 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 290 INPNSHRYMQELKTRYES 343 I PN++R+ L R+ES Sbjct: 390 IPPNAYRFRPSLNPRFES 407 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 107 LANI*RHFPQSRLSFEY 57 LAN+ R+FP L+F + Sbjct: 77 LANVIRYFPTQALNFAF 93 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +3 Query: 138 RCTWKTTAYWK*NKK 182 +CTW T+Y + N K Sbjct: 69 KCTWTITSYHRINLK 83 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,644 Number of Sequences: 438 Number of extensions: 3404 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -